PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.007G193500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family SBP
Protein Properties Length: 457aa    MW: 47373.7 Da    PI: 8.0108
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.007G193500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.61.1e-40130206278
                           -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                   SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                           C vegC+adls++++yhrrhkvCe+hsk+pvv+v+g+e rfCqqCsrfh l efD +krsCr+rL++hn+rrrk+q+
  Sobic.007G193500.1.p 130 CAVEGCKADLSKCRDYHRRHKVCEAHSKTPVVVVAGREMRFCQQCSRFHLLAEFDADKRSCRKRLDGHNRRRRKPQP 206
                           **************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.9E-34122191IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.872127204IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-38128209IPR004333Transcription factor, SBP-box
PfamPF031109.7E-31130203IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 457 aa     Download sequence    Send to blast
MDWDLKAPGA WDLAELEHEQ HAAATAAAAG PSGGHANAGV AGTGTGCRPP PGAGGAPAEC  60
SVDLKLGGLG EPGAAPPARR EREAAAAAAA AAGKVASASS GAAAGAKRPR PGGQHQQGQG  120
QHQQQQCPSC AVEGCKADLS KCRDYHRRHK VCEAHSKTPV VVVAGREMRF CQQCSRFHLL  180
AEFDADKRSC RKRLDGHNRR RRKPQPDTMA SASFITSQQG TRFSPFAPPR LEASWPGVIK  240
TEESPYYTHQ IPLGSSSNRQ QHFVGSTTPA YAKEGRRFPF LQEGEISFAT GVVLEPPACQ  300
PLLKTVAVAP PESSSSSSAG GGNKMFSDGL TRVLDSECAL SLLSAPANSS GIDVSRMVRP  360
TEHVPMAQPV VSGLQFGSSS WFSPRPQAST GVTAGSGFPS CPAVVEGEQQ QLNTVLSPHD  420
NEVNYGGMFH VGGGSGGGGE GSSDGGTSSS MPFSWQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-251302031184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1106110KRPRP
2186203KRSCRKRLDGHNRRRRKP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.98704e-87callus| panicle
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9643610.0EU964361.1 Zea mays clone 278288 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002445815.10.0hypothetical protein SORBIDRAFT_07g026220
SwissprotQ49I570.0TGA1B_MAIZE; Teosinte glume architecture 1
TrEMBLC5YHS90.0C5YHS9_SORBI; Putative uncharacterized protein Sb07g026220
STRINGSb07g026220.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP17553795
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.14e-42SBP family protein